PPARδ agonist raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-01-13 and is reviewed periodically as new material appears.
Products sold as cardarine have been found to contain incorrect compounds, variable amounts, or no active ingredient at all. Independent testing is required to verify identity and purity. Common analytical approaches include high-performance liquid chromatography, mass spectrometry, and nuclear magnetic resonance for structural confirmation. These methods can distinguish GW501516 from related PPAR agonists and from unrelated steroids. For regulators and researchers, such verification is central to interpreting both biological results and adverse event reports.
Cardarine is prohibited in competitive sport under the World Anti-Doping Agency code, where it is classified as a metabolic modulator. It is not approved as a prescription medicine in the United States, European Union, or other major markets. Regulatory action has focused on its presence in sports and in products marketed as research chemicals. Because it has no accepted medical indication, supply is often unregulated. This status creates legal and safety uncertainties for anyone who encounters the substance.
Anti-doping laboratories detect GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be used in some programs. Detection depends on factors such as dose, timing, metabolism, and the sensitivity of the assay. Published methods describe limits of detection in the low nanogram per milliliter range for related compounds. Exact detection windows are not fixed for all situations and remain an area of ongoing study.
Safety discussions about cardarine frequently cite rodent carcinogenicity findings reported in the 2000s. In those studies, treated animals developed tumors at multiple sites, leading sponsors to discontinue clinical development. The relevance of these findings to humans has not been resolved, but they are a major reason the compound is not approved. Current literature emphasizes uncertainty about long-term effects and the risks of unregulated use. Regulators and health agencies have not established a safe human exposure level.
Cardarine is a synthetic compound also known as GW501516, GW-501516, and sometimes endurobol. It was developed as a selective agonist of peroxisome proliferator-activated receptor delta, a nuclear receptor involved in fatty acid oxidation and energy metabolism. The compound was studied in preclinical models for metabolic and cardiovascular conditions, but it did not become a marketed human medicine. In regulatory and anti-doping contexts, it is treated as a prohibited substance rather than a licensed medicine.
The pharmacological interest in cardarine centers on PPARδ activation and its downstream effects on lipid handling and mitochondrial function. In animal studies, PPARδ agonists have been associated with changes in exercise endurance and fatty acid utilization, though results vary by model and protocol. Human data remain sparse, and the absence of large controlled trials limits conclusions about efficacy. Researchers often describe the compound as a tool for probing PPARδ biology rather than a proven therapeutic agent.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Prohibited in sport | Listed by WADA as a metabolic modulator. |
| Approved medical use | None in major jurisdictions | Not a registered drug. |
| Common test matrix | Urine | Most anti-doping samples use urine. |
| Typical detection method | LC-MS/MS | Detects parent compound and metabolites. |
| Reference standard storage | -20 °C, desiccated | Typical for analytical standards. |
PPARδ is a nuclear receptor that influences transcription of genes involved in fatty acid oxidation, lipid transport, and energy homeostasis. GW501516 binds and activates this receptor with high selectivity relative to PPARα and PPARγ in laboratory assays. Activation alters expression of target genes in skeletal muscle, liver, and adipose tissue in animal models. The exact clinical consequences of these changes in humans remain incompletely characterized, and observed effects in animals do not establish therapeutic benefit or safety.
Published studies have examined GW501516 in animal models of obesity, insulin resistance, and exercise endurance. Early human trials reportedly ended, and development was discontinued after preclinical findings raised concerns about cancer in some rodent studies. Regulatory agencies have not approved cardarine for any medical use. Its availability through non-pharmaceutical channels raises questions about identity, purity, and legal status that are separate from its laboratory pharmacology. Those questions are often addressed through analytical testing rather than assumptions about product labels.
Cardarine is a common name for GW501516, also GW-1516, a synthetic compound developed as a peroxisome proliferator-activated receptor delta (PPARδ) agonist. It belongs to a class of agents that modulate gene transcription related to lipid and energy metabolism. The compound was studied in preclinical and early clinical research for metabolic and cardiovascular conditions, but it did not progress to approved therapeutic use. Its name appears in fitness and sports contexts despite not being approved as a drug.
Cardarine is a common name for the investigational chemical GW501516, also written GW-1516. It was developed as a peroxisome proliferator-activated receptor delta agonist for metabolic conditions such as dyslipidemia. Early research focused on lipid handling and energy use in skeletal muscle and other tissues. The compound was never approved as a medicine. In public discussion, it is often grouped with performance-enhancing substances, although its receptor target differs from that of anabolic steroids or selective androgen receptor modulators. Regulatory and health authorities have issued warnings about its use.
GW501516 acts on PPARδ, a nuclear receptor that helps regulate fatty acid oxidation and energy homeostasis. In animal studies, activation of this receptor was associated with increased endurance and changes in lipid metabolism. Human trials examined effects on blood lipids and other metabolic markers, but the compound did not advance to approval. Rodent studies later reported tumors in multiple tissues at doses used in those experiments. Whether those findings translate to human risk remains uncertain, and the clinical relevance of the animal data is still debated.
Anti-doping laboratories identify GW501516 and related metabolites using liquid chromatography coupled with tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be analyzed. The method targets the parent compound and phase I and phase II metabolites, which extend the detection window. Because the substance is prohibited at all times, athletes can be tested outside competition. Detection limits and windows depend on the assay, sample type, and individual metabolism.
Cardarine is frequently described as a fat-burning or endurance-enhancing supplement, but these claims exceed the available evidence. The compound is not a hormone, steroid, or selective androgen receptor modulator. Research articles discuss it as a tool compound for studying PPARδ biology, while anti-doping literature focuses on its abuse and detection. Quality of unapproved products is uncertain, and independent analyses have found impurities or incorrect labeling. Open questions include whether human cancer risk resembles that seen in rodents and how often non-athletes use the substance.
Cardarine has no approved therapeutic indication and is not marketed as a medicine. The World Anti-Doping Agency lists GW501516 as a prohibited substance at all times, covering both in-competition and out-of-competition periods. National laws vary: some countries treat it as an unapproved drug subject to import controls, while others have specific restrictions on sale for human consumption. It is often sold as a research chemical, a label that does not imply safety or legality. Enforcement actions have targeted online vendors and shipments.
== Epidemiology == Obesity prevalence in Brazil has increased steadily over recent decades. Data from the Vigitel surveillance system indicate that the prevalence of obesity among adults increased from 11.8% in 2006 to 25.7% in 2024. During the same period, the prevalence of excess weight increased from 42.6% to 62.6%. The increase corresponds to a growth of approximately 118% in obesity prevalence over an eighteen-year period. No sustained decline was observed during the surveillance period. A systematic review and meta-analysis published in 2024 estimated the pooled prevalence of obesity among Brazilian adults at approximately 20%, with higher prevalence observed in the South and Southeast regions.
Tartaric acid is an important component of some commonly used foods like unripe mangoes and tamarind. Natural fruits and vegetables also contain acids. Citric acid is present in oranges, lemon and other citrus fruits. Oxalic acid is present in tomatoes, spinach, and especially in carambola and rhubarb; rhubarb leaves and unripe carambolas are toxic because of high concentrations of oxalic acid. Ascorbic acid (Vitamin C) is an essential vitamin for the human body and is present in such foods as amla (Indian gooseberry), lemon, citrus fruits, and guava. Many acids can be found in various kinds of food as additives, as they alter their taste and serve as preservatives. Phosphoric acid, for example, is a component of cola drinks. Acetic acid is used in day-to-day life as vinegar. Citric acid is used as a preservative in sauces and pickles. Carbonic acid is one of the most common acid additives that are widely added in soft drinks. During the manufacturing process, CO2 is usually pressurized to dissolve in these drinks to generate carbonic acid. Carbonic acid is very unstable and tends to decompose into water and CO2 at room temperature and pressure. Therefore, when bottles or cans of these kinds of soft drinks are opened, the soft drinks fizz and effervesce as CO2 bubbles come out. Certain acids are used as drugs. Acetylsalicylic acid (Aspirin) is used as a pain killer and for bringing down fevers.
This failure to deaminate the AMP molecules has three major effects. First, significant amounts of AMP are lost from the cell and the body. Second, ammonia is not freed when the cell does work. Third, the level of IMP in the cell is not maintained.
Acheson SA, Kirkman HN, Wolfenden R (1988). "Equilibrium of 5,6-hydration of NADH and mechanism of ATP-dependent dehydration". Biochemistry. 27 (19): 7371–5. doi:10.1021/bi00419a030. PMID 3061454. MEINHART JO, CHAYKIN S, KREBS EG (1956). "Enzymatic conversion of a reduced diphosphopyridine nucleotide derivative to reduced diphosphopyridine nucleotide". J. Biol. Chem. 220 (2): 821–9. doi:10.1016/S0021-9258(18)65307-4. PMID 13331940. Regueiro V, Campos MA, Pons J, Alberti S, Bengoechea JA (2006). "The uptake of a Klebsiella pneumoniae capsule polysaccharide mutant triggers an inflammatory response by human airway epithelial cells". Microbiology. 152 (Pt 2): 555–66. doi:10.1099/mic.0.28285-0. PMID 16436443.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
He worked on other methods of analytical separation of biological materials, notably electrophoresis and displacement chromatography, but also was influential in developing biochemical engineering within the Chemical Engineering Department at Yale. He published about 300 papers and held 9 patents. He was a member of the United States National Academy of Engineering. He received many other honors and awards and is remembered in the Horváth Laboratory of Separation Science at Innsbruck.
The mandate includes dose assessment for workers who may be exposed to increased radiation exposure and, if necessary, determination of the activity concentration of residues and radioactive substances discharged with the air or waste water.
==== Edwards v. Aguillard ==== Following the McLean ruling, which declared the teaching of "creation science" in public schools to be an unconstitutional establishment of religion, Louisiana's version of the "Equal Time" legislation was put to the test. This time, Wendell Bird was deputized by the state and ran the state's defense of the law. Dean Kenyon was advertised as the creationists' lead expert witness, however the case (which eventually became Edwards v. Aguillard when it reached the Supreme Court) was decided by summary judgment, and so never went to a full trial. Nevertheless, in written briefs and in his oral arguments, Bird relied heavily on an expert witness affidavit written by Kenyon. This affidavit is online at the TalkOrigins website. It was entered into evidence in the Kitzmiller case as evidence that Kenyon was explicitly defending "creation science"—and advocating that it be given equal time in public schools and textbooks as the "only" alternative to evolution—while at the same time working on a public school textbook, which eventually became the first "intelligent design" book, Of Pandas and People. In 1987, in Edwards v. Aguillard the Supreme Court heard a case concerning a Louisiana Law that required "creation science" be taught on an equal basis with evolution in public schools. Anti-creationists argued that this was illegal on the basis that it violated the Establishment Clause of the US Constitution. Kenyon issued an affidavit in that case, stating his support for creationism, and defining it thus:
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 is an enzyme that in humans is encoded by the PLOD3 gene. The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity.
Sources: en.wikipedia.org
Legal status varies by country, but cardarine is not approved as a medicine in major jurisdictions. It is often sold as a research chemical, a category that may not be lawful for human use. Buyers should check local laws and product labels carefully.
Anti-doping laboratories use LC-MS/MS to detect GW501516 and its metabolites, usually in urine. The method can identify the parent compound at low concentrations. Detection windows vary with dose and individual factors.
No, cardarine has no approved medical uses in major jurisdictions. Early research explored metabolic conditions, but those programs were discontinued. It is not a registered treatment for any disease.
Cardarine is an investigational synthetic compound that acts as a PPARδ agonist. It is also known as GW501516 and has been studied mainly in preclinical research. It is not an approved medicine.